Proteintech, 67864-1-Ig, Synaptophysin Monoclonal antibody

Size: 20ul / 150ul The Synaptophysin (67864-1-Ig) by Proteintech is a Monoclonal antibody targeting Synaptophysin in WB, IHC, IF/ICC, IF-P, IF-Fro, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 67864-1-Ig targets Synaptophysin in WB, IHC, IF/ICC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: PC-12 cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, pig cerebellum tissue, rabbit cerebellum tissue, rat cerebellum tissue, mouse cerebellum tissue Positive IHC detected in: mouse brain tissue, human rectal cancer tissue, rat pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse pancreas tissue, mouse brain tissue Positive IF-Fro detected in: rat brain tissue Positive IF/ICC detected in: SH-SY5Y cells, PC-12 cells Recommended dilution Western Blot (WB): WB : 1:20000-1:100000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)-FRO: IF-FRO : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000 Background Information Synaptophysin (SYP, also known as major synaptic vesicle protein p38) is a 38-kDa integral membrane glycoprotein that regulates synaptic vesicle endocytosis. It is the most abundant synaptic vesicle protein by mass. Synaptophysin is present in neuroendocrine cells and neurons that participate in synaptic transmission. Synaptophysin is a useful marker for identification of neuroendocrine cells and neoplasms. (PMID: 3010302; 21658579) Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag11803 Product name: Recombinant human Synaptophysin; SYP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 50-313 aa of BC064550 Sequence: ELQLSVDCANKTESDLSIEVEFEYPFRLHQVYFDAPTCRGGTTKVFLVGDYSSSAEFFVTVAVFAFLYSMGALATYIFLQNKYRENNKGPMLDFLATAVFAFMWLVSSSAWAKGLSDVKMATDPENIIKEMPVCRQTGNTCKELRDLVTSGLNTSVVFGFLNLVLWVGNLWFVFKETGWAAPFLRAPPGAPEKQPAPGDAYGDAGYGQGPGGYGPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM Predict reactive species Full Name: synaptophysin Calculated Molecular Weight: 313 aa, 34 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC064550 Gene Symbol: Synaptophysin Gene ID (NCBI): 6855 RRID: AB_2918622 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P08247 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.