Iright
BRAND / VENDOR: Proteintech

Proteintech, 67866-1-Ig, CSNK2B Monoclonal antibody

CATALOG NUMBER: 67866-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CSNK2B (67866-1-Ig) by Proteintech is a Monoclonal antibody targeting CSNK2B in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat, pig samples 67866-1-Ig targets CSNK2B in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples. Tested Applications Positive WB detected in: A549 cells, MCF-7 cells, LNCaP cells, HeLa cells, Jurkat cells, pig brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: human breast cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:20000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CSNK2B is a ubiquitous protein kinase which regulates metabolic pathways, signal transduction, transcription, translation, and replication. The enzyme is composed of three subunits, alpha, alpha prime and beta, which form a tetrameric holoenzyme. The alpha and alpha prime subunits are catalytic, while the beta subunit serves regulatory functions. The enzyme localizes to the endoplasmic reticulum and the Golgi apparatus. It participates in Wnt signaling, and plays a complex role in regulating the basal catalytic activity of the alpha subunit. Specification Tested Reactivity: Human, mouse, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag19180 Product name: Recombinant human CSNK2B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-215 aa of BC112017 Sequence: MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDNPNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGEAMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPMAYQLQLQAASNFKSPVKTIR Predict reactive species Full Name: casein kinase 2, beta polypeptide Calculated Molecular Weight: 215 aa, 25 kDa Observed Molecular Weight: 27 kDa GenBank Accession Number: BC112017 Gene Symbol: CSNK2B Gene ID (NCBI): 1460 RRID: AB_2918624 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P67870 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924