Proteintech, 67886-1-Ig, KDM1B Monoclonal antibody

Size: 20ul / 150ul The KDM1B (67886-1-Ig) by Proteintech is a Monoclonal antibody targeting KDM1B in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples 67886-1-Ig targets KDM1B in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, K-562 cells, C6 cells, NIH/3T3 cells, A549 cells, HeLa cells, Jurkat cells Positive FC (Intra) detected in: SW 1990 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30672 Product name: Recombinant human KDM1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 666-822 aa of NM_001364614 Sequence: FPYRFWDSKVQGADFFGHVPPSASKRGLFAVFYDMDPQKKHSVLMSVIAGEAVASVRTLDDKQVLQQCMATLRELFKEQEVPDPTKYFVTRWSTDPWIQMAYSFVKTGGSGEAYDIIAEDIQGTVFFAGEATNRHFPQTVTGAYLSGVREASKIAAF Predict reactive species Full Name: amine oxidase (flavin containing) domain 1 Calculated Molecular Weight: 92 kDa Observed Molecular Weight: 92 kDa GenBank Accession Number: NM_001364614 Gene Symbol: KDM1B Gene ID (NCBI): 221656 RRID: AB_2918643 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8NB78 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.