Proteintech, 67891-1-Ig, ARL8B Monoclonal antibody

Size: 20ul / 150ul The ARL8B (67891-1-Ig) by Proteintech is a Monoclonal antibody targeting ARL8B in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat, pig samples 67891-1-Ig targets ARL8B in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig samples. Tested Applications Positive WB detected in: K-562 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, LNCaP cells, pig brain tissue, rat brain tissue Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information ARL8B ( ADP-ribosylation factor-like 8B) , also known as ARL10C or GIE1, is a small GTPase of the Arl-family, that is associated with the lysosome. ARL8A interacts with Tubulin, and plays a role in lysosome motility, as well as in chromosomal segregation. ARL8B plays a role in the spatial distribution and positioning of lysosomes. ARL8B is regarded as a regulator of endosome to lysosome trafficking pathways of special significance for host defense. Specification Tested Reactivity: Human, mouse, rat, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag3711 Product name: Recombinant human ARL8B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-186 aa of BC013131 Sequence: MLALISRLLDWFRSLFWKEEMELTLVGLQYSGKTTFVNVIASGQFSEDMIPTVGFNMRKVTKGNVTIKIWDIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQLQGIPVLVLGNKRDLPNALDEKQLIEKMNLSAIQDREICCYSISCKEKDNIDITLQWLIQHSKSRRS Predict reactive species Full Name: ADP-ribosylation factor-like 8B Calculated Molecular Weight: 186 aa, 22 kDa Observed Molecular Weight: 22 kDa GenBank Accession Number: BC013131 Gene Symbol: ARL8B Gene ID (NCBI): 55207 RRID: AB_2918647 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9NVJ2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.