Iright
BRAND / VENDOR: Proteintech

Proteintech, 67904-1-Ig, WIF1 Monoclonal antibody

CATALOG NUMBER: 67904-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WIF1 (67904-1-Ig) by Proteintech is a Monoclonal antibody targeting WIF1 in WB, ELISA applications with reactivity to Human samples 67904-1-Ig targets WIF1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: Caco-2 cells, SW480 cells, COLO 320 cells, HT-29 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: Human Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag23972 Product name: Recombinant human WIF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC018037 Sequence: MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILKTPQNAIFFKTCQQA Predict reactive species Full Name: WNT inhibitory factor 1 Calculated Molecular Weight: 42 kDa Observed Molecular Weight: 41 kDa GenBank Accession Number: BC018037 Gene Symbol: WIF1 Gene ID (NCBI): 11197 RRID: AB_2918660 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y5W5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924