Proteintech, 67905-1-Ig, METTL7A Monoclonal antibody

Size: 20ul / 150ul The METTL7A (67905-1-Ig) by Proteintech is a Monoclonal antibody targeting METTL7A in WB, IHC, ELISA applications with reactivity to human, mouse, rat, rabbit samples 67905-1-Ig targets METTL7A in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, rabbit samples. Tested Applications Positive WB detected in: rat liver tissue, LNCaP cells, mouse lung tissue, HepG2 cells, K-562 cells, mouse liver tissue, rabbit liver tissue Positive IHC detected in: human thyroid cancer tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information methyltransferase like 7A (METTL7A) is a 244 amino acid protein which belongs to the methyltransferase super family. Methyltransferase can transfer a methyl group from a donor to an acceptor. Methylation may be linked to cancer development as methylation of tumor suppressor genes promotes tumorgenesis and metastasis. Specification Tested Reactivity: human, mouse, rat, rabbit Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29986 Product name: Recombinant human METTL7A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-244 aa of BC008180 Sequence: MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFSNLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFERFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAECSTWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYGYAVK Predict reactive species Full Name: methyltransferase like 7A Calculated Molecular Weight: 28 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC008180 Gene Symbol: METTL7A Gene ID (NCBI): 25840 RRID: AB_2918661 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9H8H3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.