Iright
BRAND / VENDOR: Proteintech

Proteintech, 67906-1-Ig, ROR2 Monoclonal antibody

CATALOG NUMBER: 67906-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ROR2 (67906-1-Ig) by Proteintech is a Monoclonal antibody targeting ROR2 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 67906-1-Ig targets ROR2 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HSC-T6 cells, NIH/3T3 cells, MDA-MB-231 cells, T-47D cells, HeLa cells, K-562 cells, Jurkat cells, 4T1 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Tyrosine-protein kinase transmembrane receptor ROR2 belongs to the ROR family of receptor tyrosine kinases (RTKs) (PMID: 12815588). ROR2 is a developmentally regulated protein that has significant expression and roles in a wide variety of tissues during early embryonic development. It was established that ROR2 plays a key role in skeletal and neural organogenesis, as well as in midgut development in the mouse, but then becomes repressed in adult tissues. It may act as a receptor for wnt ligand WNT5A which may result in the inhibition of WNT3A-mediated signaling (PMID: 25614331). Mutations in the ROR2 gene are associated with autosomal recessive Robinow syndrome and autosomal dominant brachydactyly type B (PMID: 12815588). Specification Tested Reactivity: Human, Mouse, Rat Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31197 Product name: Recombinant human ROR2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 781-943 aa of BC130522 Sequence: VSNARYVGPKQKAPPFPQPQFIPMKGQIRPMVPPPQLYIPVNGYQPVPAYGAYLPNFYPVQIPMQMAPQQVPPQMVPKPSSHHSGSGSTSTGYVTTAPSNTSMADRAALLSEGADDTQNAPEDGAQSTVQEAEEEEEGSVPETELLGDCDTLQVDEAQVQLEA Predict reactive species Full Name: receptor tyrosine kinase-like orphan receptor 2 Calculated Molecular Weight: 943 aa, 105 kDa Observed Molecular Weight: 105 kDa GenBank Accession Number: BC130522 Gene Symbol: ROR2 Gene ID (NCBI): 4920 RRID: AB_2918662 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q01974 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924