Proteintech, 67907-1-Ig, EIF5A2 Monoclonal antibody

Size: 20ul / 150ul The EIF5A2 (67907-1-Ig) by Proteintech is a Monoclonal antibody targeting EIF5A2 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, rat samples 67907-1-Ig targets EIF5A2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells Positive IHC detected in: human lung cancer tissue, human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Eukaryotic translation initiation factor 5A (EIF5A), a conserved lysine to hypusine, is strictly indispensable for the survival of eukaryotic cells. There are two EIF5A isoforms in humans: EIF5A1 and EIF5A2. EIF5A2 has been reported to be overexpressed in gallbladder cancer, upper urinary tract urothelial carcinoma, gastric cancer, prostate cancer, nasopharyngeal carcinoma, and cervical cancer. EIF5A2 upregulation in cancer tissues is associated with poor prognosis in these patients. Specification Tested Reactivity: Human, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag10852 Product name: Recombinant human EIF5A2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-153 aa of BC036072 Sequence: MADEIDFTTGDAGASSTYPMQCSALRKNGFVVLKGRPCKIVEMSTSKTGKHGHAKVHLVGIDIFTGKKYEDICPSTHNMDVPNIKRNDYQLICIQDGYLSLLTETGEVREDLKLPEGELGKEIEGKYNAGEDVQVSVMCAMSEEYAVAIKPCK Predict reactive species Full Name: eukaryotic translation initiation factor 5A2 Calculated Molecular Weight: 153 aa, 17 kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: BC036072 Gene Symbol: EIF5A2 Gene ID (NCBI): 56648 RRID: AB_2918663 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9GZV4 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.