Iright
BRAND / VENDOR: Proteintech

Proteintech, 67933-1-Ig, CARS Monoclonal antibody

CATALOG NUMBER: 67933-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CARS (67933-1-Ig) by Proteintech is a Monoclonal antibody targeting CARS in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 67933-1-Ig targets CARS in WB, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, A549 cells, HSC-T6 cells, NIH/3T3 cells, HepG2 cells, Jurkat cells, K-562 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7651 Product name: Recombinant human CARS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-353 aa of BC002880 Sequence: MADSSGQQGKGRRVQPQWSPPAGTQPCRLHLYNSLTRNKEVFIPQDGKKVTWYCCGPTVYDASHMGHARSYISFDILRRVLKDYFKFDVFYCMNITDIDDKIIKRARQNHLFEQYREKRPEAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVNSCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVLTRVSEYVPEIVNFVQKIVDNGYGYVSNGSVYFDTAKFASSEKHSYGKLVPEAVGDQKALQEGEGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPWGKGRPGWHIECSAMAG Predict reactive species Full Name: cysteinyl-tRNA synthetase Calculated Molecular Weight: 89 kDa Observed Molecular Weight: 70-85 kDa GenBank Accession Number: BC002880 Gene Symbol: CARS Gene ID (NCBI): 833 RRID: AB_2918685 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P49589 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924