Iright
BRAND / VENDOR: Proteintech

Proteintech, 67935-1-Ig, ValRS Monoclonal antibody

CATALOG NUMBER: 67935-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ValRS (67935-1-Ig) by Proteintech is a Monoclonal antibody targeting ValRS in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 67935-1-Ig targets ValRS in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, HepG2 cells, LNCaP cells, MCF-7 cells, HeLa cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag9312 Product name: Recombinant human VARS protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 916-1264 aa of BC012808 Sequence: ECGTDALRFGLCAYMSQGRDINLDVNRILGYRHFCNKLWNATKFALRGLGKGFVPSPTSQPGGHESLVDRWIRSRLTEAVRLSNQGFQAYDFPAVTTAQYSFWLYELCDVYLECLKPVLNGVDQVAAECARQTLYTCLDVGLRLLSPFMPFVTEELFQRLPRRMPQAPPSLCVTPYPEPSECSWKDPEAEAALELALSITRAVRSLRADYNLTRIRPDCFLEVADEATGALASAVSGYVQALASAGVVAVLALGAPAPQGCAVALASDRCSIHLQLQGLVDPARELGKLQAKRVEAQRQAQRLRERRAASGYPVKVPLEVQEADEAKLQQTEAELRKVDEAIALFQKML Predict reactive species Full Name: valyl-tRNA synthetase Calculated Molecular Weight: 1264 aa, 140 kDa Observed Molecular Weight: 140 kDa GenBank Accession Number: BC012808 Gene Symbol: ValRS Gene ID (NCBI): 7407 RRID: AB_2918687 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P26640 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924