Iright
BRAND / VENDOR: Proteintech

Proteintech, 67937-1-Ig, WDR1 Monoclonal antibody

CATALOG NUMBER: 67937-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WDR1 (67937-1-Ig) by Proteintech is a Monoclonal antibody targeting WDR1 in WB, ELISA applications with reactivity to human, rat samples 67937-1-Ig targets WDR1 in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: A549 cells, rat testis tissue, HEK-293 cells, U-87 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information WDR1, which belongs to the WD repeat AIP1 family, also known as AIP1, is a 606 amino acid protein that localizes to the cytoskeleton. WD repeats are approximately 30- to 40-amino acid domains containing several conserved residues, mostly including a trp-asp at the C-terminal end. WDR1 induces the disassembly of actin filaments in conjunction with ADF/cofilin family proteins (PMID:15629458, 27557945, 29751004). WDR1 mutations may impair the ability of WDR1 to regulate cofilin-mediated actin depolymerization, and are associated with periodic fever, immunodeficiency, and thrombocytopenia syndrome (PMID: 27557945,27994071,29751004). Specification Tested Reactivity: human, rat Cited Reactivity: human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30967 Product name: Recombinant human WDR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC030541 Sequence: MPYEIKKVFASLPQVERGVSKIIGGDPKGNNFLYTNGKCVILRNIDDHSRFVNCVRFSPDGNRFATASADGQIYIYDGKTGEKVCALGGSKAHDGGIYAISWSPDSTHLLSASGDKTSKIWDVSVNSVVSTFPMGSTVLDQQLGCLWQKDHLLSVSLSGYINYLDRNNPSKPLHVIKGHSKSIQCLTVHKNGGKSYIYSGSHDGHINYWDSETGENDSFAGKGHTNQVSRMTVDESGQLISCSMDDTVRYTSLMLRDYSGQGVVKLDVQPKCVAVGPGGYAVVVCIGQIVLLKDQRKCFSIDNPGYEPEVVAVHPGGDTVAIGGVDGNVRLYSILGTTLKDEGKLLEAKG Predict reactive species Full Name: WD repeat domain 1 Calculated Molecular Weight: 606 aa, 66 kDa Observed Molecular Weight: 65-66 kDa GenBank Accession Number: BC030541 Gene Symbol: WDR1 Gene ID (NCBI): 9948 RRID: AB_2918689 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O75083 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924