Iright
BRAND / VENDOR: Proteintech

Proteintech, 67943-1-Ig, ATG16L1 Monoclonal antibody

CATALOG NUMBER: 67943-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATG16L1 (67943-1-Ig) by Proteintech is a Monoclonal antibody targeting ATG16L1 in WB, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 67943-1-Ig targets ATG16L1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HSC-T6 cells, HepG2 cells, rat lung tissue, PC-12 cells, NIH/3T3 cells, 4T1 cells Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Human ATG16L1 is a 607 amino acid protein (~68 kDa) comprising three major domains: the N‐terminal ATG5 binding domain (ATG5‐BD), the central coiled‐coil domain (CCD) and a predicted C‐terminal WD40‐domain. ATG16L1α and β (Atg16L1α, 63 kDa; and Atg16L1β, 71 kDa) are the major isoforms expressed in intestinal epithelium and macrophages , and all isoforms encode exon 9, which contains Thr 300. Atg16L1 mediates the cellular degradative process of autophagy and is considered a critical regulator of inflammation based on its genetic association with inflammatory bowel disease. ATG16L1 has been implicated in Crohn's disease. (PMID: 24553140, PMID: 22740627,PMID: 28685931) Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human, rat, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14881 Product name: Recombinant human ATG16L1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 258-607 aa of BC000061 Sequence: RAISRAATKRLSQPAGGLLDSITNIFGRRSVSSFPVPQDNVDAHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPGSRLLATGGMDRRVKLWEVFGEKCEFKGSLSGSNAGITSIEFDSAGSYLLAASNDFASRIWTVDDYRLRHTLTGHSGKVLSAKFLLDNARIVSGSHDRTLKLWDLRSKVCIKTVFAGSSCNDIVCTEQCVMSRHFDKKIRFWDIRSESIVREMELLGKITALDLNPERTELLSCSRDDLLKVIDLRTNAIKQTFSAPGFKCGSDWTRVVFSPDGSYVAAGSAEGSLYIWSVLTGKVEKVLSKQHSSSINAVAWSPSGSHVVSVDKGCKAVLWAQY Predict reactive species Full Name: ATG16 autophagy related 16-like 1 (S. cerevisiae) Calculated Molecular Weight: 607 aa, 68 kDa Observed Molecular Weight: 68-75 kDa GenBank Accession Number: BC000061 Gene Symbol: ATG16L1 Gene ID (NCBI): 55054 RRID: AB_2918695 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q676U5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924