Proteintech, 67951-1-Ig, SLC7A5 Monoclonal antibody

Size: 20ul / 150ul The SLC7A5 (67951-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC7A5 in WB, ELISA applications with reactivity to human samples 67951-1-Ig targets SLC7A5 in WB, IF, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Large neutral amino acid transporter 1 LAT1(also named as SLC7A5) is a sodium- and pH-independent transporter that supplies essential amino acids (e.g., leucine, phenylalanine) to cells. It plays an important role in the blood-brain barrier (BBB), where it facilitates the transport of thyroid hormones, drugs (e.g., l-DOPA, gabapentin), and metabolites to the brain. In addition, its expression is highly upregulated in various types of human cancers, which are characterized by a high demand for amino acids for growth and proliferation. The LAT1 subunit in humans is a 507 amino acid-long polypeptide with a theoretical molecular mass of 55 kDa. The protein is hydrophobic and is predicted to be constituted by 12 transmembrane segments. The apparent molecular mass of the proteins diminished to approximately 35 - 40 kDa.(PMID: 23912240 ;PMID: 26256001) Specification Tested Reactivity: human Cited Reactivity: human, goat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20291 Product name: Recombinant human SLC7A5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 300-507 aa of BC039692 Sequence: LSTEQMLSSEAVAVDFGNYHLGVMSWIIPVFVGLSCFGSVNGSLFTSSRLFFVGSREGHLPSILSMIHPQLLTPVPSLVFTCVMTLLYAFSKDIFSVINFFSFFNWLCVALAIIGMIWLRHRKPELERPIKVNLALPVFFILACLFLIAVSFWKTPVECGIGFTIILSGLPVYFFGVWWKNKPKWLLQGIFSTTVLCQKLMQVVPQET Predict reactive species Full Name: solute carrier family 7 (cationic amino acid transporter, y+ system), member 5 Calculated Molecular Weight: 507 aa, 55 kDa Observed Molecular Weight: 35-50 kDa GenBank Accession Number: BC039692 Gene Symbol: SLC7A5 Gene ID (NCBI): 8140 RRID: AB_2918703 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q01650 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.