Proteintech, 67957-1-Ig, CLN3 Monoclonal antibody

Size: 20ul / 150ul The CLN3 (67957-1-Ig) by Proteintech is a Monoclonal antibody targeting CLN3 in WB, ELISA applications with reactivity to Human samples 67957-1-Ig targets CLN3 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, NCCIT cells, NCI-H1299 cells, A549 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Neuronal ceroid lipofuscinosis (NCL, or Batten disease) refers to a group of lethal pediatric neurodegenerative diseases originating from mutations in one of the thus far identified 13 CLN genes (Ceroid Lipofuscinosis, Neuronal type; CLN1 to CLN14) (PMID: 25051496). CLN3 is a multi-membrane-spanning protein involved in the microtubule-dependent, anterograde transport of late endosomes and lysosomes. The CLN3 gene is located on chromosome 16p12.1 and produces three mRNA splicing variants. The 438-amino-acid CLN3 protein has a calculated molecular weight of 48 kDa. It has been reported that CLN3 can be glycosylated and form a homodimeric complex (PMID: 10356317; 17286803). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31402 Product name: Recombinant human CLN3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 300-438 aa of BC002394 Sequence: QGLFELLFFWNTSLSHAQQYRWYQMLYQAGVFASRSSLRCCRIRFTWALALLQCLNLVFLLADVWFGFLPSIYLVFLIILYEGLLGGAAYVNTFHNIALETSDEHREFAMAATCISDTLGISLSGLLALPLHDFLCQLS Predict reactive species Full Name: ceroid-lipofuscinosis, neuronal 3 Calculated Molecular Weight: 438 aa, 48 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC002394 Gene Symbol: CLN3 Gene ID (NCBI): 1201 RRID: AB_2918708 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q13286 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.