Proteintech, 67960-1-Ig, ABCE1 Monoclonal antibody

Size: 20ul / 150ul The ABCE1 (67960-1-Ig) by Proteintech is a Monoclonal antibody targeting ABCE1 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, Mouse, Rat samples 67960-1-Ig targets ABCE1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: HepG2 cells, A431 cells, U2OS cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: human breast cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information ABCE1 is an ATPase that is a member of the ATP-binding cassette (ABC) transporters superfamily and OABP subfamily, it is an essential and highly conserved protein that is required for both eukaryotic translation initiation as well as ribosome biogenesis. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28493 Product name: Recombinant human ABCE1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 76-256 aa of BC016283 Sequence: PSNLEKETTHRYCANAFKLHRLPIPRPGEVLGLVGTNGIGKSTALKILAGKQKPNLGKYDDPPDWQEILTYFRGSELQNYFTKILEDDLKAIIKPQYVDQIPKAAKGTVGSILDRKDETKTQAIVCQQLDLTHLKERNVEDLSGGELQRFACAVVCIQKADIFMFDEPSSYLDVKQRLKAA Predict reactive species Full Name: ATP-binding cassette, sub-family E (OABP), member 1 Calculated Molecular Weight: 599 aa, 67 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC016283 Gene Symbol: ABCE1 Gene ID (NCBI): 6059 RRID: AB_2918711 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P61221 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.