Iright
BRAND / VENDOR: Proteintech

Proteintech, 67965-1-Ig, MFSD2 Monoclonal antibody

CATALOG NUMBER: 67965-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MFSD2 (67965-1-Ig) by Proteintech is a Monoclonal antibody targeting MFSD2 in WB, ELISA applications with reactivity to human, mouse samples 67965-1-Ig targets MFSD2 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: human placenta tissue, human testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information MFSD2, also named as MFSD2A, belongs to a large family of presumptive carbohydrate transporters with 10-12 membrane-spanning domains, is located at chromosomal position 1p34.2, and is conserved in evolution. It plays a role in thermogenesis via beta-adrenergic signaling pathway. It may be the main plasma membrane tunicamycin transporter. MFSD2 has three isoforms with MW 50 kDa and 59-60 kDa. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31028 Product name: Recombinant human MFSD2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 453-530 aa of BC092414 Sequence: AGYQTRGCSQPERVKFTLNMLVTMAPIVLILLGLLLFKMYPIDEERRRQNKKALQALRDEASSSGCSETDSTELASIL Predict reactive species Full Name: major facilitator superfamily domain containing 2 Calculated Molecular Weight: 543 aa, 60 kDa Observed Molecular Weight: 60 kDa GenBank Accession Number: BC092414 Gene Symbol: MFSD2 Gene ID (NCBI): 84879 RRID: AB_2918716 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8NA29 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924