Product Description
Size: 20ul / 150ul
The MMP7 (67990-1-Ig) by Proteintech is a Monoclonal antibody targeting MMP7 in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human samples
67990-1-Ig targets MMP7 in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: SKOV-3 cells, HT-29 cells, COLO 320 cells, A549 cells
Positive IHC detected in: human stomach cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Positive IF-P detected in: human pancreas cancer tissue
Positive IF/ICC detected in: PC-3 cells
Recommended dilution
Western Blot (WB): WB : 1:2000-1:10000
Immunohistochemistry (IHC): IHC : 1:250-1:1000
Immunofluorescence (IF)-P: IF-P : 1:200-1:800
Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
Specification
Tested Reactivity: human
Cited Reactivity: human
Host / Isotype: Mouse / IgG2a
Class: Monoclonal
Type: Antibody
Immunogen: CatNo: Ag0550 Product name: Recombinant human MMP7 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC003635 Sequence: MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLKEMQKFFGLPITGMLNSHVIEIMQKPRCGVPDVAEYSLFPN Predict reactive species
Full Name: matrix metallopeptidase 7 (matrilysin, uterine)
Calculated Molecular Weight: 29 kDa
Observed Molecular Weight: 27-30 kDa
GenBank Accession Number: BC003635
Gene Symbol: MMP7
Gene ID (NCBI): 4316
RRID: AB_2918739
Conjugate: Unconjugated
Form: Liquid
Purification Method: Protein A purification
UNIPROT ID: P09237
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924