Proteintech, 68003-1-Ig, BCAS2 Monoclonal antibody

Size: 20ul / 150ul The BCAS2 (68003-1-Ig) by Proteintech is a Monoclonal antibody targeting BCAS2 in WB, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68003-1-Ig targets BCAS2 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HepG2 cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells, HSC-T6 cells, NIH/3T3 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:1000-1:4000 Background Information Breast carcinoma amplified sequence 2 (BCAS2) is preferentially known as pre-mRNA splicing factor SPF27 and was originally characterized as an up-regulated gene by amplification in human breast cancer cells. BCAS2 has been shown to be involved in DNA damage repair through the replication protein A (RPA) complex. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag21309 Product name: Recombinant human BCAS2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-225 aa of BC005285 Sequence: MAGTGLVAGEVVVDALPYFDQGYEAPGVREAAAALVEEETRRYRPTKNYLSYLTAPDYSAFETDIMRNEFERLAARQPIELLSMKRYELPAPSSGQKNDITAWQECVNNSMAQLEHQAVRIENLELMSQHGCNAWKVYNENLVHMIEHAQKELQKLRKHIQDLNWQRKNMQLTAGSKLREMESNWVSLVSKNYEIERTIVQLENEIYQIKQQHGEANKENIRQDF Predict reactive species Full Name: breast carcinoma amplified sequence 2 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC005285 Gene Symbol: BCAS2 Gene ID (NCBI): 10286 RRID: AB_2918750 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O75934 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.