Proteintech, 68007-1-Ig, Sortilin Monoclonal antibody

Size: 20ul / 150ul The Sortilin (68007-1-Ig) by Proteintech is a Monoclonal antibody targeting Sortilin in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig samples 68007-1-Ig targets Sortilin in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: ROS1728 cells, SK-N-SH cells, SH-SY5Y cells, pig brain tissue, rabbit brain, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissue, human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: SH-SY5Y cells, HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Sortilin 1 (SORT1), is a trans-Golgi network (TGN) transmembrane protein and is a member of the Vps10p domain receptor family. SORT1 binds a number of unrelated ligands that participate in a wide range of cellular processes. It functions as a sorting receptor in the Golgi compartment and as a clearance receptor on the cell surface. Specification Tested Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28043 Product name: Recombinant human SORT1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 481-831 aa of BC023542 Sequence: EPNAVGIVIAHGSVGDAISVMVPDVYISDDGGYSWTKMLEGPHYYTILDSGGIIVAIEHSSRPINVIKFSTDEGQCWQTYTFTRDPIYFTGLASEPGARSMNISIWGFTESFLTSQWVSYTIDFKDILERNCEEKDYTIWLAHSTDPEDYEDGCILGYKEQFLRLRKSSVCQNGRDYVVTKQPSICLCSLEDFLCDFGYYRPENDSKCVEQPELKGHDLEFCLYGREEHLTTNGYRKIPGDKCQGGVNPVREVKDLKKKCTSNFLSPEKQNSKSNSVPIILAIVGLMLVTVVAGVLIVKKYVCGGRFLVHRYSVLQQHAEANGVDGVDALDTASHTNKSGYHDDSDEDLLE Predict reactive species Full Name: sortilin 1 Calculated Molecular Weight: 831 aa, 92 kDa Observed Molecular Weight: 95-100 kDa GenBank Accession Number: BC023542 Gene Symbol: Sortilin Gene ID (NCBI): 6272 ENSEMBL Gene ID: ENSG00000134243 RRID: AB_2918754 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q99523 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.