Iright
BRAND / VENDOR: Proteintech

Proteintech, 68008-1-Ig, KCNA1 Monoclonal antibody

CATALOG NUMBER: 68008-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KCNA1 (68008-1-Ig) by Proteintech is a Monoclonal antibody targeting KCNA1 in WB, ELISA applications with reactivity to Human, Pig, Mouse, Rat, Rabbit samples 68008-1-Ig targets KCNA1 in WB, ELISA applications and shows reactivity with Human, Pig, Mouse, Rat, Rabbit samples. Tested Applications Positive WB detected in: pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, pig cerebellum tissue, rabbit cerebellum tissue, rat cerebellum tissue, mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: Human, Pig, Mouse, Rat, Rabbit Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag12563 Product name: Recombinant human KCNA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-163 aa of BC101733 Sequence: MTVMSGENVDEASAAPGHPQDGSYPRQADHDDHECCERVVINISGLRFETQLKTLAQFPNTLLGNPKKRMRYFDPLRNEYFFDRNRPSFDAILYYYQSGGRLRRPVNVPLDMFSEEIKFYELGEEAMEKFREDEGFIKEEERPLPEKEYQRQVWLLFEYPESS Predict reactive species Full Name: potassium voltage-gated channel, shaker-related subfamily, member 1 (episodic ataxia with myokymia) Calculated Molecular Weight: 495 aa, 56 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC101733 Gene Symbol: KCNA1 Gene ID (NCBI): 3736 RRID: AB_2918755 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q09470 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924