Iright
BRAND / VENDOR: Proteintech

Proteintech, 68010-1-Ig, GMEB2 Monoclonal antibody

CATALOG NUMBER: 68010-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GMEB2 (68010-1-Ig) by Proteintech is a Monoclonal antibody targeting GMEB2 in WB, ELISA applications with reactivity to Human, mouse, rat samples 68010-1-Ig targets GMEB2 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, Jurkat cells, RAW 264.7 cells, HEK-293 cells, K-562 cells, PC-12 cells, HSC-T6 cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information GMEB-2 (glucocorticoid modulatory element-binding protein 2), also known as PIF79 (Parvovirus initiation factor p79) or P79PIF, is a DNA-binding protein that plays a crucial role in modulating transcription upon activation by steroid hormones. GMEB-2 is ubiquitously expressed with preferential expression in developmentally important tissues. Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31393 Product name: Recombinant human GMEB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-304 aa of BC036305 Sequence: MATPDVSVHMEEVVVVTTPDTAVDGSGVEGVKTVLVTTNLAPHGGDLTEDNMETENAAAAAAAAFTASSQLKEAVLVKMAEEGENLEAEIVYPITCGDSRANLIWRKFVCPGINVKCVQYDEHVISPKEFVHLAGKSTLKDWKRAIRMNGIMLRKIMDSGELDFYQHDKVCSNTCRSTKIDLSGARVSLSSPTSAEYIPLTPAAADVNGSPATITIETCEDPGDWTAAIGDDTFTFWRGLKDAGLLDEVIQEFHQELVETMRGLQQRVQDPPLQLRDAVLLNNIVQNFGMLDLVKKVLASHKCQ Predict reactive species Full Name: glucocorticoid modulatory element binding protein 2 Calculated Molecular Weight: 530 aa, 56 kDa Observed Molecular Weight: 68 kDa GenBank Accession Number: BC036305 Gene Symbol: GMEB2 Gene ID (NCBI): 26205 RRID: AB_2918757 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9UKD1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924