Iright
BRAND / VENDOR: Proteintech

Proteintech, 68014-1-Ig, RAB39B Monoclonal antibody

CATALOG NUMBER: 68014-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAB39B (68014-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB39B in WB, ELISA applications with reactivity to Human, mouse, rat, rabbit, pig samples 68014-1-Ig targets RAB39B in WB, ELISA applications and shows reactivity with Human, mouse, rat, rabbit, pig samples. Tested Applications Positive WB detected in: rabbit brain tissue, Jurkat cells, LNCaP cells, pig brain tissue, mouse brain tissue, pig cerebellum tissue, mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information RAB39B is a member of the RAB GTPase family with a putative role in vesicle trafficking. RAB39B is predominantly expressed in neuronal cells and is localized to the endoplasmic reticulum, Golgi and trans‐Golgi recycling endosomes. Several reports suggested that RAB39B may regulate protein trafficking and the PI3K-AKT-mTOR pathway. Mutations in RAB39B are known to be associated with X-linked intellectual disability (XLID), Parkinson's disease, and autism. Specification Tested Reactivity: Human, mouse, rat, rabbit, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27170 Product name: Recombinant human RAB39B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-213 aa of BC009714 Sequence: MEAIWLYQFRLIVIGDSTVGKSCLIRRFTEGRFAQVSDPTVGVDFFSRLVEIEPGKRIKLQIWDTAGQERFRSITRAYYRNSVGGLLLFDITNRRSFQNVHEWLEETKVHVQPYQIVFVLVGHKCDLDTQRQVTRHEAEKLAAAYGMKYIETSARDAINVEKAFTDLTRDIYELVKRGEITIQEGWEGVKSGFVPNVVHSSEEVVKSERRCLC Predict reactive species Full Name: RAB39B, member RAS oncogene family Calculated Molecular Weight: 213 aa, 25 kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: BC009714 Gene Symbol: RAB39B Gene ID (NCBI): 116442 RRID: AB_2918760 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q96DA2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924