Proteintech, 68017-1-Ig, ACOX1 Monoclonal antibody

Size: 20ul / 150ul The ACOX1 (68017-1-Ig) by Proteintech is a Monoclonal antibody targeting ACOX1 in WB, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig samples 68017-1-Ig targets ACOX1 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig samples. Tested Applications Positive WB detected in: LNCaP cells, pig liver tissue, rat liver tissue, HepG2 cells, HeLa cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells Positive FC (Intra) detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension Background Information ACOX1(Peroxisomal acyl-coenzyme A oxidase 1) is the first and rate-limiting enzyme in the peroxisomal fatty acid beta-oxidation pathway and catalyzes the desaturation of acyl-CoAs to 2-trans-enoyl-CoAs. It belongs to the acyl-CoA oxidase family and also named as ACOX, AOX, SCOX. It has 3 isoforms produced by alternative splicing with the molecular mass of 70-74 kDa and can be cleaved post-translationally into a 50-kDa and a 22-kDa subunit between Val468 and Ala469 (PMID: 10672038). Defects in ACOX1 are the cause of adrenoleukodystrophy pseudoneonatal (Pseudo-NALD). Specification Tested Reactivity: human, mouse, rat, pig Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28037 Product name: Recombinant human AOX protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 275-660 aa of BC010425 Sequence: YGTMVFVRSFLVGEAARALSKACTIAIRYSAVRHQSEMKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGYSHCSGLPNIYVNFTPSCTFEGENTVMMLQTARFLMKSYDQVHSGKLVCGMVSYLNDLPSQRIQPQQVAVWPTMVDINSPESLTEAYKLRAARLVEIAAKNLQKEVIHRKSKEVAWNLTSVDLVRASEAHCHYVVVKLFSEKLLKIQDKAIQAVLRSLCLLYSLYGISQNAGDFLQGSIMTEPQITQVNQRVKELLTLIRSDAVALVDAFDFQDVTLGSVLGRYDGNVYENLFEWAKNSPLNKAEVHESYKHLKSLQSKL Predict reactive species Full Name: acyl-Coenzyme A oxidase 1, palmitoyl Calculated Molecular Weight: 74 kDa Observed Molecular Weight: 50 kDa GenBank Accession Number: BC010425 Gene Symbol: ACOX1 Gene ID (NCBI): 51 RRID: AB_2918763 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q15067 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.