Proteintech, 68026-1-Ig, FADS2 Monoclonal antibody

Size: 20ul / 150ul The FADS2 (68026-1-Ig) by Proteintech is a Monoclonal antibody targeting FADS2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 68026-1-Ig targets FADS2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: PC-3 cells, A549 cells, LNCaP cells, U2OS cells, Jurkat cells, rat liver tissue Positive IHC detected in: mouse liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Fatty acid desaturase 2 (FADS2) is responsible for the first desaturation reaction in the synthesis of highly unsaturated fatty acids (HUFAs), such as arachidonic acid (20:4n-6) and eicosapentaenoic acid (20:5n-3), and is involved in Mead acid (20:3n-9) production during essential fatty acid deficiency (EFAD) (PMID: 29353041). This is important when temperatures changes and the membrane is under distress. It has 4 isoforms produced by alternative splicing. Specification Tested Reactivity: human, mouse, rat Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag27715 Product name: Recombinant human FADS2-Specific protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-124 aa of BC009011 Sequence: MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVIGHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTAEDMN Predict reactive species Full Name: fatty acid desaturase 2 Calculated Molecular Weight: 445 aa, 49 kDa Observed Molecular Weight: 42-45 kDa GenBank Accession Number: BC009011 Gene Symbol: FADS2 Gene ID (NCBI): 9415 RRID: AB_2923633 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: O95864 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.