Proteintech, 68034-1-Ig, ADPGK Monoclonal antibody

Size: 20ul / 150ul The ADPGK (68034-1-Ig) by Proteintech is a Monoclonal antibody targeting ADPGK in WB, ELISA applications with reactivity to Human samples 68034-1-Ig targets ADPGK in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, human placenta tissue, LNCaP cells, THP-1 cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Background Information ADP-dependent glucokinase (ADPGK) has frst been described 1994 in hyperthermophilic archaea as a novel glucose-phosphorylating enzyme dependent on ADP (adenosine diphosphate) instead of ATP (adenosine triphosphate). Highest ADPGK expression is found in immune cells of both myeloid and lymphoid lineages. Catalyzes the phosphorylation of D-glucose to D-glucose 6-phosphate using ADP as the phosphate donor. GDP and CDP can replace ADP, but with reduced efficiency (By similarity). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31242 Product name: Recombinant human ADPGK protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 362-497 aa of BC006112 Sequence: ILKEHGRSKSRASDLTRIHFHTLVYHILATVDGHWANQLAAVAAGARVAGTQACATETIDTSRVSLRAPQEFMTSHSEAGSRIVLNPNKPVVEWHREGISFHFTPVLVCKDPIRTVGLGDAISAEGLFYSEVHPHY Predict reactive species Full Name: ADP-dependent glucokinase Calculated Molecular Weight: 497 aa, 54 kDa Observed Molecular Weight: 51 kDa GenBank Accession Number: BC006112 Gene Symbol: ADPGK Gene ID (NCBI): 83440 RRID: AB_2918776 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BRR6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.