Iright
BRAND / VENDOR: Proteintech

Proteintech, 68039-1-Ig, TMOD2 Monoclonal antibody

CATALOG NUMBER: 68039-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TMOD2 (68039-1-Ig) by Proteintech is a Monoclonal antibody targeting TMOD2 in WB, IHC, ELISA applications with reactivity to Human, pig, rabbit, chicken samples 68039-1-Ig targets TMOD2 in WB, IHC, ELISA applications and shows reactivity with Human, pig, rabbit, chicken samples. Tested Applications Positive WB detected in: pig brain tissue, rabbit brain, chicken brain, pig cerebellum, rabbit cerebellum, chicken cerebellum Positive IHC detected in: human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Specification Tested Reactivity: Human, pig, rabbit, chicken Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7262 Product name: Recombinant human TMOD2 protein Source: e coli. -derived, T-HIS Tag: 6*His Domain: 1-351 aa of BC064961 Sequence: MALPFQKELEKYKNIDEDELLGKLSEEELKQLENVLDDLDPESAMLPAGFRQKDQTQKAATGPFDREHLLMYLEKEALEQKDREDFVPFTGEKKGRVFIPKEKPIETRKEEKVTLDPELEEALASASDTELYDLAAVLGVHNLLNNPKFDEETANNKGGKGPVRNVVKGEKVKPVFEEPPNPTNVEISLQQMKANDPSLQEVNLNNIKNIPIPTLREFAKALETNTHVKKFSLAATRSNDPVAIAFADMLKVNKTLTSLNIESNFITGTGILALVEALKENDTLTEIKIDNQRQQLGTAVEMEIAQMLEENSRILKFGYQFTKQGPRTRVAAAITKNNDLVRKKRVEADRR Predict reactive species Full Name: tropomodulin 2 (neuronal) Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 39-40 kDa GenBank Accession Number: BC064961 Gene Symbol: TMOD2 Gene ID (NCBI): 29767 RRID: AB_2918781 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9NZR1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924