Proteintech, 68070-1-Ig, PTPRF Monoclonal antibody

Size: 20ul / 150ul The PTPRF (68070-1-Ig) by Proteintech is a Monoclonal antibody targeting PTPRF in WB, ELISA applications with reactivity to Human, mouse, rat samples 68070-1-Ig targets PTPRF in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HSC-T6 cells, 4T1 cells, HEK293 cells, A549 cells, LNCaP cells, MCF-7 cells, U2OS cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag25441 Product name: Recombinant human PTPRF protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1080-1150 aa of BC048768 Sequence: HLVSIRTAPDLLPHKPLPASAYIEDGRFDLSMPHVQDPSLVRWFYIVVVPIDRVGGSMLTPRWSTPEELEL Predict reactive species Full Name: protein tyrosine phosphatase, receptor type, F Calculated Molecular Weight: 1898 aa, 212 kDa Observed Molecular Weight: 150 kDa, 213 kDa GenBank Accession Number: BC048768 Gene Symbol: PTPRF Gene ID (NCBI): 5792 RRID: AB_2918811 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P10586 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.