Iright
BRAND / VENDOR: Proteintech

Proteintech, 68071-1-Ig, STRA8 Monoclonal antibody

CATALOG NUMBER: 68071-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The STRA8 (68071-1-Ig) by Proteintech is a Monoclonal antibody targeting STRA8 in WB, ELISA applications with reactivity to human, mouse, rabbit samples 68071-1-Ig targets STRA8 in WB, IF, ELISA applications and shows reactivity with human, mouse, rabbit samples. Tested Applications Positive WB detected in: human testis tissue, rabbit testis tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Stimulated by retinoic acid 8 (Stra8), one of genes induced by retinoic acid (RA), is required for the meiotic initiation of male spermatogenesis. Stimulated by Retinoic Acid Gene 8 (STRA8) protein has been proposed as the molecular effector of Retinoic Acid (RA) involved in meiosis-inductive activity. Stra8 is a 45-kDa vertebrate-specific gene, without significant homologous proteins, expressed in the cytoplasm and nuclei of germ cells between mitosis and meiosis and presents exclusively in the embryonic and postnatal gonads of mammals. (PMID: 30106128, PMID: 31253359) Specification Tested Reactivity: human, mouse, rabbit Cited Reactivity: mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29680 Product name: Recombinant human STRA8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 187-330 aa of NM_182489 Sequence: NLSEERKASLRQAWAQKHRGPATLAEACREPACAEGSVKDSGVDSQGASCSLVSTPEEILFEDAFDVASFLDKSEVPSTSSSSSVLASCNPENPEEKFQLYMQIINFFKGLSCANTQVKQEASFPVDEEMIMLQCTETFDDEDL Predict reactive species Full Name: stimulated by retinoic acid gene 8 homolog (mouse) Calculated Molecular Weight: 37 kDa Observed Molecular Weight: 43-60 kda GenBank Accession Number: NM_182489 Gene Symbol: STRA8 Gene ID (NCBI): 346673 RRID: AB_2918812 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q7Z7C7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924