Iright
BRAND / VENDOR: Proteintech

Proteintech, 68079-1-Ig, RAB12 Monoclonal antibody

CATALOG NUMBER: 68079-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RAB12 (68079-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB12 in WB, ELISA applications with reactivity to Human, mouse, rat samples 68079-1-Ig targets RAB12 in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HEK-293 cells, HepG2 cells, HUVEC cells, A549 cells, LNCaP cells, U-251 cells, HSC-T6 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag31627 Product name: Recombinant human RAB12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 105-244 aa of NM_001025300 Sequence: NSITSAYYRSAKGIILVYDITKKETFDDLPKWMKMIDKYASEDAELLLVGNKLDCETDREITRQQGEKFAQQITGMRFCEASAKDNFNVDEIFLKLVDDILKKMPLDILRNELSNSILSLQPEPEIPPELPPPRPHVRCC Predict reactive species Full Name: RAB12, member RAS oncogene family Calculated Molecular Weight: 27KD Observed Molecular Weight: 27-30 kDa GenBank Accession Number: NM_001025300 Gene Symbol: RAB12 Gene ID (NCBI): 201475 RRID: AB_2918816 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q6IQ22 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924