Iright
BRAND / VENDOR: Proteintech

Proteintech, 68083-1-Ig, GDAP1 Monoclonal antibody

CATALOG NUMBER: 68083-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GDAP1 (68083-1-Ig) by Proteintech is a Monoclonal antibody targeting GDAP1 in WB, IHC, IF-P, ELISA applications with reactivity to Human, mouse, rat, rabbit, pig samples 68083-1-Ig targets GDAP1 in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, mouse, rat, rabbit, pig samples. Tested Applications Positive WB detected in: pig brain tissue, Rabbit brain tissue, mouse brain tissue, rat brain tissue Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:200-1:800 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information GDAP1 is a member of the ganglioside-induced differentiation-associated protein family, which may play a role in a signal transduction pathway during neuronal development. Mutations in this gene have been associated with various forms of Charcot-Marie-Tooth Disease and neuropathy. Specification Tested Reactivity: Human, mouse, rat, rabbit, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28616 Product name: Recombinant human GDAP1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-257 aa of BC024939 Sequence: MRLNSTGEVPVLIHGENIICEATQIIDYLEQTFLDERTPRLMPDKESMYYPRVQHYRELLDSLPMDAYTHGCILHPELTVDSMIPAYATTRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHRLKFLGFARRNWGNGKRPNLETYYERVLKRKTFNKVLGHVNNILISAVLPTAFRVAKKRAPKVLGTTLV Predict reactive species Full Name: ganglioside-induced differentiation-associated protein 1 Calculated Molecular Weight: 358 aa, 41 kDa Observed Molecular Weight: 38-40 kDa GenBank Accession Number: BC024939 Gene Symbol: GDAP1 Gene ID (NCBI): 54332 RRID: AB_2918820 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q8TB36 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924