Iright
BRAND / VENDOR: Proteintech

Proteintech, 68103-1-Ig, Bcl2 Monoclonal antibody

CATALOG NUMBER: 68103-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Bcl2 (68103-1-Ig) by Proteintech is a Monoclonal antibody targeting Bcl2 in WB, IHC, IF/ICC, ELISA applications with reactivity to mouse, rat samples 68103-1-Ig targets Bcl2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with mouse, rat samples. Tested Applications Positive WB detected in: HSC-T6 cells, C2C12 cells, NIH/3T3 cells, mouse spleen tissue, mouse brain tissue, rat spleen tissue, RAW 264.7 cells, rat brain tissue Positive IHC detected in: mouse kidney tissue, rat skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information Bcl2 is a member of the B cell lymphoma 2 protein family. Members of this family regulate cell death in multiple cell types and can have either proapoptotic or antiapoptotic activities. The protein encoded by this gene inhibits mitochondrial-mediated apoptosis. This protein is an integral outer mitochondrial membrane protein that functions as part of signaling pathway that controls mitochondrial permeability in response to apoptotic stimuli. This protein may also play a role in neuron cell survival and autophagy. Abnormal expression and chromosomal translocations of this gene are associated with cancer progression in numerous tissues. Specification Tested Reactivity: mouse, rat Cited Reactivity: mouse, rat, pig, chicken, goat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag24261 Product name: Recombinant mouse Bcl2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-236 aa of NM-009741 Sequence: MAQAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDADAAPLGAAPTPGIFSFQPESNPMPAVHRDMAARTSPLRPLVATAGPALSPVPPVVHLTLRRAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKTLLSLALVGACITLGAYLGHK Predict reactive species Full Name: B-cell leukemia/lymphoma 2 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: NM-009741 Gene Symbol: Bcl2 Gene ID (NCBI): 12043 RRID: AB_2923635 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P10417 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924