Proteintech, 68107-1-Ig, SLC25A16 Monoclonal antibody

Size: 20ul / 150ul The SLC25A16 (68107-1-Ig) by Proteintech is a Monoclonal antibody targeting SLC25A16 in WB, ELISA applications with reactivity to Human samples 68107-1-Ig targets SLC25A16 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information GDA, also named as SLC25A16, GDC, ML7, hML7, belongs to the mitochondrial carrier family. GDA encodes a protein that contains three tandemly repeated mitochondrial carrier protein domains. The encoded protein is localized in the mitochondrion inner membrane and facilitates the rapid transport and exchange of molecules between the cytosol and the mitochondrial matrix space. This gene has been associated with Graves' disease (PMID:11158296, 1457817). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4891 Product name: Recombinant human GDA protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-332 aa of BC030266 Sequence: MAAATAAAALAAADPPPAMPQAAGAGGPTTRRDFYWLRSFLAGGIAGCCAKTTVAPLDRVKVLLQAHNHHYKHLGVFSALRAVPQKEGFLGLYKGNGAMMIRIFPYGAIQFMAFEHYKTLITTKLGISGHVHRLMAGSMAGMTAVICTYPLDMVRVRLAFQVKGEHSYTGIIHAFKTIYAKEGGFFGFYRGLMPTILGMAPYAGVSFFTFGTLKSVGLSHAPTLLGRPSSDNPNVLVLKTHVNLLCGGVAGAIAQTISYPFDVTRRRMQLGTVLPEFEKCLTMRDTMKYVYGHHGIRKGLYRGLSLNYIRCIPSQAVAFTTYELMKQFFHLN Predict reactive species Full Name: solute carrier family 25 (mitochondrial carrier; Graves disease autoantigen), member 16 Calculated Molecular Weight: 36 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC030266 Gene Symbol: GDA Gene ID (NCBI): 8034 RRID: AB_2923636 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P16260 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.