Iright
BRAND / VENDOR: Proteintech

Proteintech, 68111-1-Ig, FTO Monoclonal antibody

CATALOG NUMBER: 68111-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FTO (68111-1-Ig) by Proteintech is a Monoclonal antibody targeting FTO in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse, pig samples 68111-1-Ig targets FTO in WB, IHC, FC (Intra), RIP, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: LNCaP cells, MDA-MB-231 cells, NIH/3T3 cells, HeLa cells, Jurkat cells, K-562 cells, HUVEC cells, mouse brain tissue Positive IHC detected in: mouse brain tissue, human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:5000-1:10000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information Fat mass and obesity-associated protein (FTO) has efficient oxidative demethylation activity targeting the abundant N6-methyladenosine (m6A) residues in RNA in vitro. Variants in the FTO (fat mass and obesity associated) gene are associated with increased body mass index in humans. Specification Tested Reactivity: human, mouse, pig Cited Reactivity: human, mouse, rat, pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26095 Product name: Recombinant human FTO protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 400-505 aa of NM_001080432 Sequence: MAQLEALWKKMEGVTNAVLHEVKREGLPVEQRNEILTAILASLTARQNLRREWHARCQSRIARTLPADQKPECRPYWEKDDASMPLPFDLTDIVSELRGQLLEAKP Predict reactive species Full Name: fat mass and obesity associated Calculated Molecular Weight: 58 kDa Observed Molecular Weight: 58 kDa GenBank Accession Number: NM_001080432 Gene Symbol: FTO Gene ID (NCBI): 79068 RRID: AB_2923640 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9C0B1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924