Iright
BRAND / VENDOR: Proteintech

Proteintech, 68112-1-Ig, CEP89, CCDC123 Monoclonal antibody

CATALOG NUMBER: 68112-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CEP89, CCDC123 (68112-1-Ig) by Proteintech is a Monoclonal antibody targeting CEP89, CCDC123 in WB, IF-P, ELISA applications with reactivity to human, mouse samples 68112-1-Ig targets CEP89, CCDC123 in WB, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, A549 cells, Neuro-2a cells, A431 cells, SH-5Y5Y cells, U-251 cells, SH-SY5Y cells Positive IF-P detected in: mouse eye tissue, hTERT-RPE1 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information CCDC123 (as known as CEP123), also named as CEP89, encodes for a protein required for ciliogenesis. It plays a role in mitochondrial metabolism by modulating complex IV activity. It has been shown that CEP123 is localized to the distal appendages of the mother centriolecep and the localization of CEP123 is cell cycle-dependent with its levels decreasing during mitosis. CEP123 depletion can cause defects in ciliary vesicle formationcep and prevent the formation of a ciliary vesicle at the distal end of the mother centriole. It is possible that CEP123 is involved in regulating the recruitment of membranes to the centrosome through its interaction with CEP290 (PMID:23575228, 23789104, 23348840). Specification Tested Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28339 Product name: Recombinant human CCDC123 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 248-343 aa of BC136328 Sequence: MDLNNMNQSLTLELNTMKQAMKELQLKLKGMEKEKRKLKEAEKASSQEVAAPELLYLRKQAQELVDENDGLKMTVHRLNVELSRYQTKFRHLSKEE Predict reactive species Full Name: coiled-coil domain containing 123 Calculated Molecular Weight: 783 aa, 90 kDa Observed Molecular Weight: 90 kDa GenBank Accession Number: BC136328 Gene Symbol: CEP89 Gene ID (NCBI): 84902 RRID: AB_2923641 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q96ST8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924