Iright
BRAND / VENDOR: Proteintech

Proteintech, 68114-1-Ig, TRP2/DCT Monoclonal antibody

CATALOG NUMBER: 68114-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TRP2/DCT (68114-1-Ig) by Proteintech is a Monoclonal antibody targeting TRP2/DCT in WB, IF/ICC, ELISA applications with reactivity to human, mouse, pig samples 68114-1-Ig targets TRP2/DCT in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, pig samples. Tested Applications Positive WB detected in: A375 cells, HL-60 cells, pig skin tissue, mouse skin tissue, mouse testis tissue Positive IF/ICC detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information DCT(L-dopachrome Delta-isomerase) is also named as TYRP2,TRP2 and belongs to the tyrosinase family.human TYRP2 protein has 83% identity and 90% similarity to the mouse sequence and has all the structural characteristics of the tyrosinase protein family, including a signal peptide, 15 conserved cysteine residues, 2 copper-binding domains, and a C-terminal membrane-spanning region(PMID:8206391). Specification Tested Reactivity: human, mouse, pig Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag26165 Product name: Recombinant human DCT protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-350 aa of BC028311 Sequence: MSPLWWGFLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNA Predict reactive species Full Name: dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2) Calculated Molecular Weight: 519 aa, 59 kDa Observed Molecular Weight: 55-63 kDa GenBank Accession Number: BC028311 Gene Symbol: DCT Gene ID (NCBI): 1638 RRID: AB_2923643 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P40126 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924