Proteintech, 68115-1-Ig, PACSIN1 Monoclonal antibody

Size: 20ul / 150ul The PACSIN1 (68115-1-Ig) by Proteintech is a Monoclonal antibody targeting PACSIN1 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat, pig, rabbit, chicken samples 68115-1-Ig targets PACSIN1 in WB, IHC, IF/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit, chicken samples. Tested Applications Positive WB detected in: pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue, chicken brain tissue Positive IHC detected in: mouse cerebellum tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse brain tissue Positive IF/ICC detected in: SH-SY5Y cells Positive FC (Intra) detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:2000-1:8000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension Background Information PACSIN1 (also known as syndapin-1) is a member of the protein kinase C and casein kinase substrate in neurons (PACSIN) family. In mammals, the PACSIN family is comprised of three members, PACSIN1, PACSIN2, and PACSIN3 (PMID: 34990060). PACSIN1 is expressed mainly in neurons, whereas PACSIN2 is ubiquitously expressed in all tissues, and PACSIN3 is expressed mainly in skeletal muscle and the heart (PMID: 23668323). All of these three members contain an N-terminal F-BAR domain and a C-terminal SH3 domain. PACSIN1 plays a role in endocytosis and endosomal recycling. Meanwhile, it has a role in actin remodeling and microtubule nucleation and also plays a particular role in membrane shaping and reconstruction (PMID: 23035120; 34422904). PACSIN1 is involved in neuromorphogenesis and the regulation of the nervous system, and the inappropriate expression of PACSIN1 has been associated with some neurological diseases, including schizophrenia, Alzheimer's disease, and Huntington's disease (PMID: 34990060). Specification Tested Reactivity: human, mouse, rat, pig, rabbit, chicken Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4102 Product name: Recombinant human PACSIN1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 243-389 aa of BC040228 Sequence: VFLKEVLLDIKRHLNLAENSSYIHVYRELEQAIRGADAQEDLRWFRSTSGPGMPMNWPQFEEWNPDLPHTTTKKEKQPKKAEGVALTNATGAVESTSQAGDRGSVSSYDRGQPYATEWSDDESGNPFGGSETNGGANPFEDDSKGVR Predict reactive species Full Name: protein kinase C and casein kinase substrate in neurons 1 Calculated Molecular Weight: 444 aa, 51 kDa Observed Molecular Weight: 48-51 kDa GenBank Accession Number: BC040228 Gene Symbol: PACSIN1 Gene ID (NCBI): 29993 RRID: AB_2923644 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BY11 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.