Iright
BRAND / VENDOR: Proteintech

Proteintech, 68121-1-Ig, MAN1B1 Monoclonal antibody

CATALOG NUMBER: 68121-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The MAN1B1 (68121-1-Ig) by Proteintech is a Monoclonal antibody targeting MAN1B1 in WB, IF/ICC, ELISA applications with reactivity to Human samples 68121-1-Ig targets MAN1B1 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HeLa cells, MCF-7 cells, HEK-293 cells, LNCaP cells, HaCaT cells, U-87 MG cells, HepG2 cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information MAN1B1, also known as ERMAN1, MANA-ER, belongs to the glycosyl hydrolase 47 family. MAN1B1 is involved in glycoprotein quality control targeting of misfolded glycoproteins for degradation, specifically converting Man9GlcNAc to Man8GlcNAc isomer B. At high enzyme concentrations, it further trims the carbohydrates to Man5-6GlcNAc2 (PMID: 18003979). Mutations in MAN1B1 cause autosomal-recessive intellectual disability. This gene has been associated with Rafiq syndrome (PMID: 21763484). Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28302 Product name: Recombinant human MAN1B1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 350-699 aa of BC002953 Sequence: LFLRKAEDFGNRLMPAFRTPSKIPYSDVNIGTGVAHPPRWTSDSTVAEVTSIQLEFRELSRLTGDKKFQEAVEKVTQHIHGLSGKKDGLVPMFINTHSGLFTHLGVFTLGARADSYYEYLLKQWIQGGKQETQLLEDYVEAIEGVRTHLLRHSEPSKLTFVGELAHGRFSAKMDHLVCFLPGTLALGVYHGLPASHMELAQELMETCYQMNRQMETGLSPEIVHFNLYPQPGRRDVEVKPADRHNLLRPETVESLFYLYRVTGDRKYQDWGWEILQSFSRFTRVPSGGYSSINNVQDPQKPEPRDKMESFFLGETLKYLFLLFSDDPNLLSLDAYVFNTEAHPLPIWTPA Predict reactive species Full Name: mannosidase, alpha, class 1B, member 1 Calculated Molecular Weight: 80 kDa Observed Molecular Weight: 80 kDa GenBank Accession Number: BC002953 Gene Symbol: MAN1B1 Gene ID (NCBI): 11253 RRID: AB_2923649 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q9UKM7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924