Proteintech, 68142-1-Ig, MYL6 Monoclonal antibody

Size: 20ul / 150ul The MYL6 (68142-1-Ig) by Proteintech is a Monoclonal antibody targeting MYL6 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat, pig, rabbit samples 68142-1-Ig targets MYL6 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig heart tissue, A549 cells, rabbit heart tissue, rat heart tissue, mouse heart tissue Positive IHC detected in: human colon tissue, rat heart tissue, mouse skeletal muscle tissue, rat skeletal muscle tissue, human kidney tissue, mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)/ICC: IF/ICC : 1:500-1:2000 Background Information Myosin is a hexameric ATPase cellular motor protein. It is composed of two heavy chains, two nonphosphorylatable alkali light chains, and two phosphorylatable regulatory light chains. MYL6 (Myosin light polypeptide 6), encodes a myosin alkali light chain that is expressed in smooth muscle and non-muscle tissues. Expression of MYL6 is high in fibroblasts and myoblasts (PMID:8188229, PubMed:2304459, PMID:2722814). Specification Tested Reactivity: Human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13091 Product name: Recombinant human MYL6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-151 aa of BC006781 Sequence: MCDFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG Predict reactive species Full Name: myosin, light chain 6, alkali, smooth muscle and non-muscle Calculated Molecular Weight: 17 kDa Observed Molecular Weight: 17-25 kDa GenBank Accession Number: BC006781 Gene Symbol: MYL6 Gene ID (NCBI): 4637 RRID: AB_2935258 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P60660 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.