Iright
BRAND / VENDOR: Proteintech

Proteintech, 68146-1-Ig, HBS1L Monoclonal antibody

CATALOG NUMBER: 68146-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HBS1L (68146-1-Ig) by Proteintech is a Monoclonal antibody targeting HBS1L in WB, IF/ICC, ELISA applications with reactivity to Human samples 68146-1-Ig targets HBS1L in WB, IF/ICC, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: NCI-H1299 cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells, LNCaP cells, HeLa cells Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information HBS1L (HBS1-like), also known as EF-1a or ERFS, is a 684 amino acid protein that belongs to the GTP-binding elongation factor family and exists as multiple alternatively spliced isoforms. Expressed in kidney, brain, heart, placenta, liver, muscle and pancreas, HSB1L is thought to play a role in controlling fetal hemoglobin levels, specifically influencing platelet, monocyte and erythrocyte hemoglobin content. The gene encoding HBS1L maps to a locus on human chromosome 6 that is associated with sickle cell anemia and beta-thalassemia, suggesting a role for HBS1L in the pathogenesis of blood disorders.This antibody specifically recognizes the 75kd human HBS1L protein. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag0388 Product name: Recombinant human HBS1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 43-262 aa of BC001465 Sequence: SRRDKPSVEPVEEYDYEDLKESSNSVSNHQLSGFDQARLYSCLDHMREVLGDAVPDEILIEAVLKNKFDVQKALSGVLEQDRVQSLKDKNEATVSTGKIAKGKPVDSQTSRSESEIVPKVAKMTVSGKKQTMGFEVPGVSSEENGHSFHTPQKGPPIEDAIASSDVLETASKSANPPHTIQASEEQSSTPAPVKKSGKLRQQIDVKAELEKRQGGKQLLN Predict reactive species Full Name: HBS1-like (S. cerevisiae) Calculated Molecular Weight: 75 kDa Observed Molecular Weight: 75 kDa GenBank Accession Number: BC001465 Gene Symbol: HBS1L Gene ID (NCBI): 10767 RRID: AB_2923670 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y450 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924