Iright
BRAND / VENDOR: Proteintech

Proteintech, 68210-1-Ig, GSTM5 Monoclonal antibody

CATALOG NUMBER: 68210-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GSTM5 (68210-1-Ig) by Proteintech is a Monoclonal antibody targeting GSTM5 in WB, ELISA applications with reactivity to Human, mouse, rat, pig, rabbit samples 68210-1-Ig targets GSTM5 in WB, ELISA applications and shows reactivity with Human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: rabbit brain tissue, pig liver tissue, rabbit liver tissue, rat brain tissue, mouse brain tissue, mouse liver tissue, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information GSTM5, Glutathione S-transferases, belongs to eukaryotic and prokaryotic phase II metabolic isozymes family. It can catalyze the conjugation of the reduced form of glutathione (GSH) to xenobiotic substrates for detoxification. GSTM5 undergo epigenetic repression in AMD (age-related macular degeneration) RPE/choroid, which may increase susceptibility to oxidative stress in AMD retinas (PMID: 22410570). GSTM5 was found in brain, lung and testis (PMID: 9230131). Specification Tested Reactivity: Human, mouse, rat, pig, rabbit Cited Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag6054 Product name: Recombinant human GSTM5 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-218 aa of BC058881 Sequence: MPMTLGYWDIRGLAHAIRLLLEYTDSSYVEKKYTLGDAPDYDRSQWLNEKFKLGLDFPNLPYLIDGTHKITQSNAILRYIARKHNLCGETEEEKIRVDILENQVMDNHMELVRLCYDPDFEKLKPKYLEELPEKLKLYSEFLGKRPWFAGDKITFVDFLAYDVLDMKRIFEPKCLDAFLNLKDFISRFEGLKKISAYMKSSQFLRGLLFGKSATWNSK Predict reactive species Full Name: glutathione S-transferase mu 5 Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 26 kDa GenBank Accession Number: BC058881 Gene Symbol: GSTM5 Gene ID (NCBI): 2949 RRID: AB_2935298 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P46439 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924