Proteintech, 68211-1-Ig, Integrin alpha 1 Monoclonal antibody

Size: 20ul / 150ul The Integrin alpha 1 (68211-1-Ig) by Proteintech is a Monoclonal antibody targeting Integrin alpha 1 in WB, IF-P, ELISA applications with reactivity to human samples 68211-1-Ig targets Integrin alpha 1 in WB, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells, human placenta tissue Positive IF-P detected in: human placenta tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information The integrins are a superfamily of cell adhesion receptors that bind to extracellular matrix ligands, cell-surface ligands, and soluble ligands (PMID: 17543136). They are transmembrane αβ heterodimers and at least 24 distinct integrin heterodimers are formed by the combination of 18 α and eight β known subunits (PMID: 17543136; 20029421). In addition to mediating cell adhesion, integrins also play important roles in modulating signal transduction pathways that control cellular responses including migration, proliferation, differentiation, and apoptosis (PMID:19118207). Integrin alpha-1 (ITGA1, CD49a) combines with the beta 1 subunit (ITGB1, CD29) to form a cell-surface receptor for collagen and laminin. This receptor is involved in cell-cell adhesion and may play a role in inflammation and fibrosis. Integrin alpha-1 is a transmembrane glycoprotein with an apparent molecular weight of 180-250 kDa, larger than the calculated molecular weight of 131 kDa (PMID: 2475259; 3257425; 11557277; 18840653). Specification Tested Reactivity: human Host / Isotype: Mouse / IgG2a Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag30631 Product name: Recombinant human Integrin alpha-1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 980-1141 aa of BC137121 Sequence: GNEINIFYLIRKSGSFPMPELKLSISFPNMTSNGYPVLYPTGLSSSENANCRPHIFEDPFSINSGKKMTTSTDHLKRGTILDCNTCKFATITCNLTSSDISQVNVSLILWKPTFIKSYFSSLNLTIRGELRSENASLVLSSSNQKRELAIQISKDGLPGRVP Predict reactive species Full Name: integrin, alpha 1 Calculated Molecular Weight: 1179 aa, 131 kDa Observed Molecular Weight: 180 kDa GenBank Accession Number: BC137121 Gene Symbol: Integrin alpha 1 Gene ID (NCBI): 3672 RRID: AB_2935299 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: P56199 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.