Iright
BRAND / VENDOR: Proteintech

Proteintech, 68215-1-Ig, RTN3 Monoclonal antibody

CATALOG NUMBER: 68215-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RTN3 (68215-1-Ig) by Proteintech is a Monoclonal antibody targeting RTN3 in WB, IP, ELISA applications with reactivity to Human samples 68215-1-Ig targets RTN3 in WB, IP, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, LNCaP cells, HeLa cells, HEK-293 cells, Jurkat cells, K-562 cells Positive IP detected in: A549 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Background Information Reticulon (RTN) proteins are a group of membrane-bound proteins that largely reside in endoplasmic reticulum (ER). Reticulon proteins share a common sequence feature, the reticulon homology domain (RHD). Four mammalian reticulons (RTN1-4) exist. Reticulon3 (RTN3) is highly expressed in neurons. RTN3 has been shown to modulate secretory pathway protein trafficking. It is a negative modulator of BACE1 (β-secretase) proteolytic activity. RTN3 may induce caspase-8 cascade and apoptosis and may favor BCL2 translocation to the mitochondria upon endoplasmic reticulum stress. Specification Tested Reactivity: Human Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag13766 Product name: Recombinant human RTN3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-236 aa of BC011394 Sequence: MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKTQIDHYVGIARDQTKSIVEKIQAKLPGIAKKKAE Predict reactive species Full Name: reticulon 3 Calculated Molecular Weight: 113 kDa Observed Molecular Weight: 25-28 kDa GenBank Accession Number: BC011394 Gene Symbol: RTN3 Gene ID (NCBI): 10313 RRID: AB_2935303 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: O95197 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924