Iright
BRAND / VENDOR: Proteintech

Proteintech, 68248-1-Ig, PECR Monoclonal antibody

CATALOG NUMBER: 68248-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PECR (68248-1-Ig) by Proteintech is a Monoclonal antibody targeting PECR in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 68248-1-Ig targets PECR in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: LNCaP cells, HSC-T6 cells, HeLa cells, HepG2 cells, Jurkat cells, NIH/3T3 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information Peroxisomal trans-2-enoyl-CoA reductase (PECR) is also called TERP and TECR, which is located on chromosome q35 with 86627 bases. It can participate in carbon chain elongation in fatty acid metabolism and catalyze the last reaction of four long chain fatty acid elongation cycles. Each cycle of PECR adds two carbons to the long chain and very long chain fatty acid (VLCFA) chains, reducing the intermediate of trans-2,3-enoyl coenzyme A fatty acid to acyl coenzyme A, which can further extend the carbon chain by entering a new elongation cycle. Meanwhile, PECR is a peroxisome protein involved in fatty acid synthesis and plays an important role in milk fat synthesis. The molecular mass of PECR is 33 kDa. (PMID: 31467878) Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag7022 Product name: Recombinant human PECR protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-303 aa of BC002529 Sequence: MASWAKGRSYLAPGLLQGQVAIVTGGATGIGKAIVKELLELGSNVVIASRKLERLKSAADELQANLPPTKQARVIPIQCNIRNEEEVNNLVKSTLDTFGKINFLVNNGGGQFLSPAEHISSKGWHAVLETNLTGTFYMCKAVYSSWMKEHGGSIVNIIVPTKAGFPLAVHSGAARAGVYNLTKSLALEWACSGIRINCVAPGVIYSQTAVENYGSWGQSFFEGSFQKIPAKRIGVPEEVSSVVCFLLSPAASFITGQSVDVDGGRSLYTHSYEVPDHDNWPKGAGDLSVVKKMKETFKEKAKL Predict reactive species Full Name: peroxisomal trans-2-enoyl-CoA reductase Calculated Molecular Weight: 33 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC002529 Gene Symbol: PECR Gene ID (NCBI): 55825 RRID: AB_2935334 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9BY49 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924