Iright
BRAND / VENDOR: Proteintech

Proteintech, 68268-1-Ig, ZHX2 Monoclonal antibody

CATALOG NUMBER: 68268-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZHX2 (68268-1-Ig) by Proteintech is a Monoclonal antibody targeting ZHX2 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68268-1-Ig targets ZHX2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: SH-SY5Y cells, HEK-293 cells, LNCaP cells, HeLa cells, Jurkat cells, pig brain tissue, rabbit brain tissue, rat brain tissue, mouse brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Zinc fingers and homeoboxes protein 2 is a protein that in humans is encoded by the ZHX2 gene. ZHX2 Act as a transcriptional repressor, represses the promoter activity of the CDC25C gene stimulated by NFYA (PMID:12741956). In addition to forming homodimers, this protein heterodimerizes with member 1 of the zinc fingers and homeoboxes family. Specification Tested Reactivity: human, mouse, rat, pig, rabbit Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag14420 Product name: Recombinant human ZHX2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 488-837 aa of BC042145 Sequence: SDHRYRCQRGIVHITSESLAKDQLAIAASRHGRTYHAYPDFAPQKFKEKTQGQVKILEDSFLKSSFPTQAELDRLRVETKLSRREIDSWFSERRKLRDSMEQAVLDSMGSGKKGQDVGAPNGALSRLDQLSGAQLTSSLPSPSPAIAKSQEQVHLLRSTFARTQWPTPQEYDQLAAKTGLVRTEIVRWFKENRCLLKTGTVKWMEQYQHQPMADDHGYDAVARKATKPMAESPKNGGDVVPQYYKDPKKLCEEDLEKLVTRVKVGSEPAKDCLPAKPSEATSDRSEGSSRDGQGSDENEESSVVDYVEVTVGEEDAISDRSDSWSQAAAEGVSELAESDSDCVPAEAGQA Predict reactive species Full Name: zinc fingers and homeoboxes 2 Calculated Molecular Weight: 837 aa, 92 kDa Observed Molecular Weight: 92-100 kDa GenBank Accession Number: BC042145 Gene Symbol: ZHX2 Gene ID (NCBI): 22882 RRID: AB_2935352 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9Y6X8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924