Proteintech, 68290-1-Ig, RFC3 Monoclonal antibody

Size: 20ul / 150ul The RFC3 (68290-1-Ig) by Proteintech is a Monoclonal antibody targeting RFC3 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 68290-1-Ig targets RFC3 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: LNCaP cells, HSC-T6 cells, NIH/3T3 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Background Information RFC3, also known as RFC38, is a 356 amino acid protein, which localizes in the nucleus. Replication factor C (RFC) is a component of the eukaryotic DNA polymerase. In all eukaryotic cell cycles, it is essential for DNA duplication, DNA injury repair, and checkpoint control. RFC consists of five subunits (RFC1-5). The interrelationships between RFC2, RFC3, and the c-MYC oncogene (transcription factor) can induce cell division and proliferation. RFC3 is associated with liver, breast, esophageal and ovarian cancer, and serves a critical role in cellular proliferation, invasion, and metastasis. RFC3 exists in two isoforms with molecular weights of 34 kDa and 38-40 kDa. Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag28365 Product name: Recombinant human RFC3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-356 aa of BC000149 Sequence: MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELYGVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCLAVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPFTADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF Predict reactive species Full Name: replication factor C (activator 1) 3, 38kDa Calculated Molecular Weight: 40 aa, 6 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: BC000149 Gene Symbol: RFC3 Gene ID (NCBI): 5983 RRID: AB_2935370 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P40938 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.