Iright
BRAND / VENDOR: Proteintech

Proteintech, 68291-1-Ig, NRCAM Monoclonal antibody

CATALOG NUMBER: 68291-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The NRCAM (68291-1-Ig) by Proteintech is a Monoclonal antibody targeting NRCAM in WB, IF-P, ELISA applications with reactivity to Human, Mouse, Rat, Pig samples 68291-1-Ig targets NRCAM in WB, IF-P, ELISA applications and shows reactivity with Human, Mouse, Rat, Pig samples. Tested Applications Positive WB detected in: rat brain tissue, pig brain tissue, rat cerebellum tissue, mouse brain tissue, pig cerebellum tissue Positive IF-P detected in: mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information Neuronal cell adhesion molecule (NRCAM) is a member of the L1 subfamily of cell adhesion molecules (CAMs) that belong to the immunoglobulin superfamily (PMID: 11329126). NRCAM is a transmembrane protein composed of six Ig-like domains and five fibronectin type-III repeats in the extracellular region, with a highly conserved cytoplasmic tail. It is mainly expressed in the nervous system and is involved in neuron-neuron adhesion and promotes directional signaling during axonal cone growth. NRCAM is also expressed outside the nervous system. Altered expression of NRCAM has been associated with tumor progression in diverse organs (PMID: 22182708). Specification Tested Reactivity: Human, Mouse, Rat, Pig Host / Isotype: Mouse / IgG2b Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag20558 Product name: Recombinant human NRCAM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 446-628 aa of BC098401 Sequence: EPPRILTPANTLYQVIANRPALLDCAFFGSPLPTIEWFKGAKGSALHEDIYVLHENGTLEIPVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDATWIVKQPEYAVVQRGSMVSFECKVKHDHTLSLTVLWLKDNRELPSDERFTVDKDHLVVADVSDDDSGTYTCVANTTLDSVSASAVLSVV Predict reactive species Full Name: neuronal cell adhesion molecule Calculated Molecular Weight: 1304 aa, 144 kDa Observed Molecular Weight: 130-140 kDa GenBank Accession Number: BC098401 Gene Symbol: NRCAM Gene ID (NCBI): 4897 RRID: AB_2935371 Conjugate: Unconjugated Form: Liquid Purification Method: Protein A purification UNIPROT ID: Q92823 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924