Iright
BRAND / VENDOR: Proteintech

Proteintech, 68316-1-Ig, Ataxin 2 Monoclonal antibody

CATALOG NUMBER: 68316-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Ataxin 2 (68316-1-Ig) by Proteintech is a Monoclonal antibody targeting Ataxin 2 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse, rat samples 68316-1-Ig targets Ataxin 2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: LNCaP cells, HeLa cells, HEK-293 cells, HepG2 cells, MCF-7 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, 4T1 cells Positive IHC detected in: rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: rat brain tissue Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information ATXN2 contains a repeat structure with 22 or 23 triplets coding for glutamine and the (CAG)8CAA(CAG)4CAA(CAG)8 sequence; expansion of this domain to a size ≥34 triplets with a pure CAG sequence primarily causes autosomal dominant SCA2 [PMID:18418684], while ATXN2 expansions with CAA interruptions were observed as the cause of Levo-dopa responsive Parkinson's disease [PMID:10668726]. ATXN2 expansions associated with ALS were reported to be interrupted by at least one CAA triplet [PMID:21537950] Specification Tested Reactivity: human, mouse, rat Host / Isotype: Mouse / IgM Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag17402 Product name: Recombinant human Ataxin 2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 251-600 aa of BC114546 Sequence: GSDQRVVNGGVPWPSPCPSPSSRPPSRYQSGPNSLPPRAATPTRPPSRPPSRPSRPPSHPSAHGSPAPVSTMPKRMSSEGPPRMSPKAQRHPRNHRVSAGRGSISSGLEFVSHNPPSEAATPPVARTSPSGGTWSSVVSGVPRLSPKTHRPRSPRQNSIGNTPSGPVLASPQAGIIPTEAVAMPIPAASPTPASPASNRAVTPSSEAKDSRLQDQRQNSPAGNKENIKPNETSPSFSKAENKGISPVVSEHRKQIDDLKKFKNDFRLQPSSTSESMDQLLNKNREGEKSRDLIKDKIEPSAKDSFIENSSSNCTSGSSKPNSPSISPSILSNTEHKRGPEVTSQGVQTSS Predict reactive species Full Name: ataxin 2 Calculated Molecular Weight: 1313 aa, 140 kDa Observed Molecular Weight: 140-150 kDa GenBank Accession Number: BC114546 Gene Symbol: ATXN2 Gene ID (NCBI): 6311 RRID: AB_3085052 Conjugate: Unconjugated Form: Liquid Purification Method: Caprylic acid/ammonium sulfate precipitation UNIPROT ID: Q99700 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924