Proteintech, 68320-1-Ig, Collagen Type III Monoclonal antibody

Size: 20ul / 150ul The Collagen Type III (68320-1-Ig) by Proteintech is a Monoclonal antibody targeting Collagen Type III in WB, IHC, IF/ICC, IF-P, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples 68320-1-Ig targets Collagen Type III in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples. Tested Applications Positive WB detected in: pig colon tissue, human placenta tissue, human rectum tissue, rabbit large intestine tissue, rat colon tissue Positive IHC detected in: human ovary tumor tissue, human hepatocirrhosis tissue, human placenta tissue, mouse skin tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human colon cancer tissue Positive IF/ICC detected in: MCF-7 cells Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Type III collagen is a fibrillar-forming collagen comprising three α1(III) chains and is expressed in early embryos and throughout embryogenesis (PMID: 9050868). In the adult, type III collagen is a major component of the extracellular matrix in a variety of internal organs and skin. It occurs in most soft connective tissues along with type I collagen (PMID: 2445760). COL3A1 gene encodes type III procollagen. Mutations in this gene are associated with Ehlers-Danlos syndrome type IV, and with aortic and arterial aneurysms (PMID: 10706896; 2243125; 18389341). Specification Tested Reactivity: human, mouse, rat, pig, rabbit Cited Reactivity: human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag4229 Product name: Recombinant human COL3A1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1150-1466 aa of BC028178 Sequence: DGTSGHPGPIGPPGPRGNRGERGSEGSPGHPGQPGPPGPPGAPGPCCGGVGAAAIAGIGGEKAGGFAPYYGDEPMDFKINTDEIMTSLKSVNGQIESLISPDGSRKNPARNCRDLKFCHPELKSGEYWVDPNQGCKLDAIKVFCNMETGETCISANPLNVPRKHWWTDSSAEKKHVWFGESMDGGFQFSYGNPELPEDVLDVQLAFLRLLSSRASQNITYHCKNSIAYMDQASGNVKKALKLMGSNEGEFKAEGNSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAVRLPIVDIAPYDIGGPDQEFGVDVGPVCFL Predict reactive species Full Name: collagen, type III, alpha 1 Calculated Molecular Weight: 1466 aa, 139 kDa Observed Molecular Weight: 130 kDa GenBank Accession Number: BC028178 Gene Symbol: COL3A1 Gene ID (NCBI): 1281 RRID: AB_2935393 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: P02461 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.