Proteintech, 68337-1-Ig, THYN1 Monoclonal antibody

Size: 20ul / 150ul The THYN1 (68337-1-Ig) by Proteintech is a Monoclonal antibody targeting THYN1 in WB, IHC, ELISA applications with reactivity to Human, mouse samples 68337-1-Ig targets THYN1 in WB, IHC, ELISA applications and shows reactivity with Human, mouse samples. Tested Applications Positive WB detected in: LNCaP cells, U2OS cells, HeLa cells, HepG2 cells, K-562 cells, Jurkat cells, MOLT-4 cells Positive IHC detected in: mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information THYN1, also named as THY28, is a 28-32 kDa protein which located mainly in the nucleus. It appears to correlate with induction of apoptosis. (PMID:14601557) Specification Tested Reactivity: Human, mouse Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag8617 Product name: Recombinant human THYN1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-166 aa of BC006978 Sequence: MSRPRKRLAGTSGSDKGLSGKRTKTENSGEALAKVEDSNPQKTSATKNCLKNLSSHWLMKSEPESRLEKGVDVKFSIEDLKAQPKQTTCWDGVRNYQARNFLRAMKLGEEAFFYHSNCKEPGIAGLMKIVKEAYPDHTQFEKNNPHYDPSSKEDNPKWSMKSLILF Predict reactive species Full Name: thymocyte nuclear protein 1 Calculated Molecular Weight: 225aa,26 kDa; 166aa,19 kDa Observed Molecular Weight: 28 kDa GenBank Accession Number: BC006978 Gene Symbol: THYN1 Gene ID (NCBI): 29087 RRID: AB_3085061 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q9P016 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.