Iright
BRAND / VENDOR: Proteintech

Proteintech, 68351-1-Ig, ATPAF2 Monoclonal antibody

CATALOG NUMBER: 68351-1-Ig
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ATPAF2 (68351-1-Ig) by Proteintech is a Monoclonal antibody targeting ATPAF2 in WB, IHC, IF/ICC, ELISA applications with reactivity to Human, mouse, rat samples 68351-1-Ig targets ATPAF2 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: HCT 116 cells, LNCaP cells, MCF-7 cells, HeLa cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells Positive IHC detected in: mouse heart tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunohistochemistry (IHC): IHC : 1:250-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600 Background Information ATP synthase mitochondrial F1 complex assembly factor 2 (ATPAF2) also name as ATP12 and ATP12p, is an essential house keeping protein. ATPAF2 is an assembly factor for the F1 component of mitochondrial ATP synthase. This protein binds specifically to the F1 alpha subunit and is thought to prevent this subunit from forming nonproductive homooligomers during enzyme assembly. The calculated MW is 33 kDa, 68351-1-Ig can detect bands around 30 kDa and 50 kDa, the larger band may correspond to dimer or complex form. (PMID: 1826907, 11410595) Specification Tested Reactivity: Human, mouse, rat Host / Isotype: Mouse / IgG1 Class: Monoclonal Type: Antibody Immunogen: CatNo: Ag29065 Product name: Recombinant human ATPAF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 42-192 aa of BC032126 Sequence: PPTERKRFYQNVSITQGEGGFEINLDHRKLKTPQAKLFTVPSEALAIAVATEWDSQQDTIKYYTMHLTTLCNTSLDNPTQRNKDQLIRAAVKFLDTDTICYRVEEPETLVELQRNEWDPIIEWAEKRYGVEISSSTSIMGPSIPAKTREVL Predict reactive species Full Name: ATP synthase mitochondrial F1 complex assembly factor 2 Calculated Molecular Weight: 289 aa, 33 kDa Observed Molecular Weight: ~30 kDa GenBank Accession Number: BC032126 Gene Symbol: ATPAF2 Gene ID (NCBI): 91647 RRID: AB_3085074 Conjugate: Unconjugated Form: Liquid Purification Method: Protein G purification UNIPROT ID: Q8N5M1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924